PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp2g21790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 333aa    MW: 36586.2 Da    PI: 5.2203
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp2g21790genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.2e-18223257135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Tp2g21790 223 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 257
                99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.0E-811311IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.807217253IPR000679Zinc finger, GATA-type
SMARTSM004012.7E-17217267IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-16219281No hitNo description
Gene3DG3DSA:3.30.50.102.2E-14221255IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.71E-15222269No hitNo description
PfamPF003201.2E-15223257IPR000679Zinc finger, GATA-type
PROSITE patternPS003440223248IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEEEPQEFFH TADHFAVDDL LVDFSNDDDE DNDLIADSDG ANTATAIADS SNSSSLSTAG  60
LLSFHGDVQD GTSFSGDLCL PSDELAELEW LSNFVEDSFS TNDVQKLQLI SGHQTRPDPK  120
PESSPENPNS SSPIFTTDVS VPAKARSKRS RAATCNWASR GLLMEAVYDN PFTGETVISS  180
YHLSPPTSPT STAQLGKKPA IDGGIRRKKD SSPDSGGTEE RRCLHCATDK TPQWRTGPMG  240
PKTLCNACGV RYKSGRLVPE YRPAASPTFV LTKHSNSHRK VMELRRQKEM TKAHHEFIHH  300
HHGTETAMIF DVSSDGDDYL IHHNVGPDFR QLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151105.10.0PREDICTED: GATA transcription factor 12
RefseqXP_013643773.10.0PREDICTED: GATA transcription factor 12
SwissprotP697811e-179GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A078DG080.0A0A078DG08_BRANA; BnaA06g27920D protein
TrEMBLM4D0660.0M4D066_BRARP; Uncharacterized protein
STRINGBra009864.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-140GATA transcription factor 12